PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000676.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family CAMTA
Protein Properties Length: 1052aa    MW: 119351 Da    PI: 6.5179
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000676.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1181.78.3e-57211372118
                     CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYah 87 
                              l+ ++rwl++ ei++iL+n++k++++ e++++p++gsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+++vl+cyYah
  Itr_sc000676.1_g00005.1  21 LEAQHRWLRPAEICEILKNYQKFQIAPEPPNTPPNGSLFLFDRKVLRYFRKDGHKWRKKKDGKTVKEAHERLKAGSIDVLHCYYAH 106
                              5679********************************************************************************** PP

                     CG-1  88 seenptfqrrcywlLeeelekivlvhylevk 118
                              +een++fqrr+yw+Leee+++ivlvhy+evk
  Itr_sc000676.1_g00005.1 107 GEENENFQRRSYWMLEEEMSHIVLVHYREVK 137
                              ****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143781.96316142IPR005559CG-1 DNA-binding domain
SMARTSM010761.6E-7819137IPR005559CG-1 DNA-binding domain
PfamPF038598.2E-5022135IPR005559CG-1 DNA-binding domain
PfamPF018335.2E-6476555IPR002909IPT domain
SuperFamilySSF812962.33E-16477563IPR014756Immunoglobulin E-set
Gene3DG3DSA:2.60.40.102.4E-6477551IPR013783Immunoglobulin-like fold
PROSITE profilePS5029720.288631770IPR020683Ankyrin repeat-containing domain
CDDcd002041.01E-14646758No hitNo description
SuperFamilySSF484033.42E-18650761IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.206.0E-19651764IPR020683Ankyrin repeat-containing domain
PfamPF127963.2E-8671761IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500889.591699731IPR002110Ankyrin repeat
SMARTSM002480.0023699728IPR002110Ankyrin repeat
SMARTSM0024838738767IPR002110Ankyrin repeat
SuperFamilySSF525403.98E-7870925IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0001531874896IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500966.852875904IPR000048IQ motif, EF-hand binding site
SMARTSM000150.01897919IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.578898922IPR000048IQ motif, EF-hand binding site
PfamPF006122.0E-4902919IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 1052 aa     Download sequence    Send to blast
MATESRRYGL NAQLDIDQIL LEAQHRWLRP AEICEILKNY QKFQIAPEPP NTPPNGSLFL  60
FDRKVLRYFR KDGHKWRKKK DGKTVKEAHE RLKAGSIDVL HCYYAHGEEN ENFQRRSYWM  120
LEEEMSHIVL VHYREVKGNR VNFNHVKESQ IAIPGYQESE DTTSLNSAVA SEYEDAESVY  180
IQQKNPVAHS FLEVQSSMMQ KAQDELSVSL YPGPLANDHQ GQFSAISGIN FPSIVQGNQN  240
RNTANIYVPC QGHGFTSWKN IEETSTARYQ PALSSMNSDT ISAVQGQEDT TIGFTNNLGN  300
KQKLMNCVYA LEEWKTSEGD SLQSSEWSVD QKLNPDQACD FSTKQKPIEF CDFPTKHKHP  360
MQNDLQVQLT DADGGNFAKT KLDSDLNMRI NTDHSALKQP LLNGFLRQEL KKLDSFDRWV  420
NKELEDVNEP HMQTSSGNYW DNVGNEDGVD ESTIASQVQQ DTYVLSPSLS QDQFFSITEF  480
SPNWAYAGTE IKIRITGRFL KSQQEVDKCN WACMFGELEV PAEVISDGVL RCLTPIQKVG  540
RVPFYVTCSN RLACSEVREF EFRVNEIENA NSGSSKESLL NMRFGNLLSL ESVSFENSVP  600
GNMDYVSHLT STINSLLKED NSEWEHMFPH TSEDQLHQKF LKEKLRLWLL QKVVEGGKGP  660
NVLDESGQGV LHFAAALDYD WAIPPTLVAG VNVNFRDVNG WTALHWAAFC GRERMVVFLI  720
ALGAAPGALT DPTPQHPSGR TPADLASSNG HKGIAGYLAE ASLSTHLSSL ELKENKEDKN  780
RDASGVKAIH GVSERAATPV NDGDLPYGLS LKDSLAAVRN ATQAAARIHQ VFRVQSFQRK  840
QIKEYGDGEV GLSDERALSL LAVRKNRAGQ NNEPLHVAAM RIQNKFRSWK GRKDFLLIRQ  900
QIIKIQAHVR GHQVRKNYRK ITWSVGILEK VILRWRRKGS GLRGFKSEAL AAEGHNMQDQ  960
PKQEDDYDFL KEGRKQTEER LQKALARVQS MVQYPEARDQ YRRLLNVVSE MQETKNKYDK  1020
VLKRSGRTYD FDEDLMELEA FLNDDTFMPT AS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00042PBMTransfer from AT2G22300Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613616.10.0PREDICTED: calmodulin-binding transcription activator 3 isoform X2
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLE5D5L10.0E5D5L1_SOLLC; Calmodulin-binding protein
STRINGVIT_07s0141g00250.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22302146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1